Lineage for d2ymxl2 (2ymx L:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766826Domain d2ymxl2: 2ymx L:108-213 [228582]
    automated match to d1g9ml2
    complexed with gol

Details for d2ymxl2

PDB Entry: 2ymx (more details), 1.9 Å

PDB Description: crystal structure of inhibitory anti-ache fab408
PDB Compounds: (L:) fab antibody light chain

SCOPe Domain Sequences for d2ymxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymxl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d2ymxl2:

Click to download the PDB-style file with coordinates for d2ymxl2.
(The format of our PDB-style files is described here.)

Timeline for d2ymxl2: