SCOPe 2.05: Domain d3zcfc_: 3zcf C:

Lineage for d3zcfc_ (3zcf C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109644] (4 PDB entries)
   Uniprot P99999

8. Domain d3zcfc_: 3zcf C: [228573]
   automated match to d1j3sa_
   complexed with hec

Details for d3zcfc_

PDB Entry: 3zcf, 1.65 Å

PDB Description: Structure of recombinant human cytochrome c

PDB Compounds: (C:) cytochrome c

SCOPe Domain Sequences for d3zcfc_:

Sequence; same for both SEQRES and ATOM records:

>d3zcfc_ a.3.1.1 (C:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

Timeline for d3zcfc_:

• d3zcfc_ first appeared in SCOPe 2.03
  
• d3zcfc_ appears in SCOPe 2.04
  
• d3zcfc_ appears in SCOPe 2.06
  
• d3zcfc_ appears in the current release, SCOPe 2.08