SCOPe 2.06: Domain d3vxtd2: 3vxt D:113-241

Lineage for d3vxtd2 (3vxt D:113-241)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3vxtd2: 3vxt D:113-241 [228561]
   Other proteins in same PDB: d3vxta2, d3vxtc2
   automated match to d3q5ya2

Details for d3vxtd2

PDB Entry: 3vxt, 2.5 Å

PDB Description: t36-5 tcr specific for hla-a24-nef134-10

PDB Compounds: (D:) T36-5 TCR beta chain

SCOPe Domain Sequences for d3vxtd2:

Sequence; same for both SEQRES and ATOM records:

>d3vxtd2 b.1.1.0 (D:113-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3vxtd2:

• d3vxtd2 first appeared in SCOPe 2.03
  
• d3vxtd2 appears in SCOPe 2.05
  
• d3vxtd2 appears in SCOPe 2.07
  
• d3vxtd2 appears in the current release, SCOPe 2.08