![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries) |
![]() | Domain d4mayb1: 4may B:3-94 [228556] Other proteins in same PDB: d4maya2, d4mayb2, d4mayc1, d4mayc2 automated match to d1jk8b2 complexed with so4 |
PDB Entry: 4may (more details), 2.2 Å
SCOPe Domain Sequences for d4mayb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mayb1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]} spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn sqkevlegarasvdrvcrhnyevayrgilqrr
Timeline for d4mayb1:
![]() Domains from other chains: (mouse over for more information) d4maya1, d4maya2, d4mayc1, d4mayc2 |