Lineage for d1pla__ (1pla -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species Parsley (Petroselinum crispum) [TaxId:4043] [49510] (2 PDB entries) 
Domain d1pla__: 1pla - [22855]
Details for d1pla__
PDB Entry: 1pla (more details)
PDB Description: high-resolution solution structure of reduced parsley plastocyanin
SCOP Domain Sequences for d1pla__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pla__ b.6.1.1 (-) Plastocyanin {Parsley (Petroselinum crispum)}
aevklgsddgglvfspssftvaagekitfknnagfphnivfdedevpagvnaekisqpey
lngagetyevtltekgtykfycephagagmkgevtvn
SCOP Domain Coordinates for d1pla__:
Click to download the PDB-style file with coordinates for d1pla__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pla__:
- d1pla__ appears in SCOP 1.57
- d1pla__ appears in the current release, SCOPe 2.08, called d1plaa_
View in 3D