SCOPe 2.08: Domain d4khza2: 4khz A:236-371

Lineage for d4khza2 (4khz A:236-371)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d4khza2: 4khz A:236-371 [228478]
   Other proteins in same PDB: d4khza1, d4khzb1, d4khze_, d4khzf1, d4khzf2, d4khzg_
   automated match to d2awna1
   complexed with pgv

Details for d4khza2

PDB Entry: 4khz, 2.9 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose

PDB Compounds: (A:) Binding-protein-dependent transport systems inner membrane component

SCOPe Domain Sequences for d4khza2:

Sequence; same for both SEQRES and ATOM records:

>d4khza2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

Timeline for d4khza2:

• d4khza2 first appeared in SCOPe 2.03
  
• d4khza2 appears in SCOPe 2.07