Lineage for d1plc__ (1plc -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (8 PDB entries) 
Domain d1plc__: 1plc - [22846]
Details for d1plc__
PDB Entry: 1plc (more details), 1.33 Å
PDB Description: accuracy and precision in protein crystal structure analysis: restrained least-squares refinement of the crystal structure of poplar plastocyanin at 1.33 angstroms resolution
SCOP Domain Sequences for d1plc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plc__ b.6.1.1 (-) Plastocyanin {Poplar (Populus nigra), variant italica}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d1plc__:
Click to download the PDB-style file with coordinates for d1plc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1plc__:
- d1plc__ appears in SCOP 1.57
- d1plc__ appears in the current release, SCOPe 2.08, called d1plca_
View in 3D