Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Lymphocyte kinase (lck) [56153] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56154] (35 PDB entries) |
Domain d4c3fa_: 4c3f A: [228453] automated match to d3mpma_ complexed with 7kw |
PDB Entry: 4c3f (more details), 1.72 Å
SCOPe Domain Sequences for d4c3fa_:
Sequence, based on SEQRES records: (download)
>d4c3fa_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee rnyihrnlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainygtf tiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcw kerpedrptfdylrsvledff
>d4c3fa_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} wevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkqlqh qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee rnyihrnlraanilvsdtlsckiadfglarliedneytarfpikwtapeainygtftiks dvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerp edrptfdylrsvledff
Timeline for d4c3fa_: