Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Amicyanin [49505] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [49506] (33 PDB entries) Uniprot P22364 |
Domain d1mdab_: 1mda B: [22845] Other proteins in same PDB: d1mdah_, d1mdaj_, d1mdal_, d1mdam_ complexed with cu |
PDB Entry: 1mda (more details), 2.5 Å
SCOPe Domain Sequences for d1mdab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdab_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]} atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d1mdab_: