SCOPe 2.05: Domain d4guzd_: 4guz D:

Lineage for d4guzd_ (4guz D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (17 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [228435] (1 PDB entry)

8. Domain d4guzd_: 4guz D: [228437]
   automated match to d1gx3a_

Details for d4guzd_

PDB Entry: 4guz, 1.8 Å

PDB Description: structure of the arylamine n-acetyltransferase from mycobacterium abscessus

PDB Compounds: (D:) Probable arylamine n-acetyl transferase

SCOPe Domain Sequences for d4guzd_:

Sequence; same for both SEQRES and ATOM records:

>d4guzd_ d.3.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq

Timeline for d4guzd_:

• d4guzd_ first appeared in SCOPe 2.03
  
• d4guzd_ appears in SCOPe 2.04
  
• d4guzd_ is called d4guzd1 in SCOPe 2.06
  
• d4guzd_ appears in the current release, SCOPe 2.08, called d4guzd1