Lineage for d4guzd_ (4guz D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634901Species Mycobacterium abscessus [TaxId:561007] [228435] (1 PDB entry)
  8. 1634905Domain d4guzd_: 4guz D: [228437]
    automated match to d1gx3a_

Details for d4guzd_

PDB Entry: 4guz (more details), 1.8 Å

PDB Description: structure of the arylamine n-acetyltransferase from mycobacterium abscessus
PDB Compounds: (D:) Probable arylamine n-acetyl transferase

SCOPe Domain Sequences for d4guzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guzd_ d.3.1.0 (D:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vprgshmwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhva
ldipavqakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlv
vrlaaeqwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdg
sepgwlsrhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelhe
iqpgvgrktrqltpaevlatlreifgielgaddstlllerlaeq

SCOPe Domain Coordinates for d4guzd_:

Click to download the PDB-style file with coordinates for d4guzd_.
(The format of our PDB-style files is described here.)

Timeline for d4guzd_: