SCOPe 2.04: Domain d4bgca_: 4bgc A:

Lineage for d4bgca_ (4bgc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)

6. Protein automated matches [228419] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [228420] (1 PDB entry)

8. Domain d4bgca_: 4bgc A: [228421]
   automated match to d1t1da_

Details for d4bgca_

PDB Entry: 4bgc, 1.2 Å

PDB Description: T1 domain of the renal potassium channel Kv1.3

PDB Compounds: (A:) potassium voltage-gated channel subfamily a member 3

SCOPe Domain Sequences for d4bgca_:

Sequence; same for both SEQRES and ATOM records:

>d4bgca_ d.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mervvinisglrfetqlktlcqfpetllgdpkrrmryfdplrneyffdrnrpsfdailyy
yqsggrirrpvnvpidifseeirfyqlgeeamekfredegfl

Timeline for d4bgca_:

• d4bgca_ first appeared in SCOPe 2.03
  
• d4bgca_ appears in SCOPe 2.05
  
• d4bgca_ appears in the current release, SCOPe 2.08, called d4bgca1