SCOP 1.73: Domain d1aaja_: 1aaj A:

Lineage for d1aaja_ (1aaj A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries)

8. Domain d1aaja_: 1aaj A: [22841]

Details for d1aaja_

PDB Entry: 1aaj, 1.8 Å

PDB Description: crystal structure analysis of amicyanin and apoamicyanin from paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms resolution

PDB Compounds: (A:) amicyanin

SCOP Domain Sequences for d1aaja_:

Sequence; same for both SEQRES and ATOM records:

>d1aaja_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

Timeline for d1aaja_:

• d1aaja_ first appeared (with stable ids) in SCOP 1.55, called d1aaj__
  
• d1aaja_ was called d1aaj__ in SCOP 1.71
  
• d1aaja_ appears in SCOP 1.75
  
• d1aaja_ appears in the current release, SCOPe 2.08