Lineage for d4mbca_ (4mbc A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1430131Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1430132Protein automated matches [226867] (10 species)
    not a true protein
  7. 1430188Species Streptococcus pneumoniae [TaxId:760835] [226426] (7 PDB entries)
  8. 1430190Domain d4mbca_: 4mbc A: [228390]
    automated match to d4em7a_
    complexed with 28g

Details for d4mbca_

PDB Entry: 4mbc (more details), 1.75 Å

PDB Description: structure of streptococcus pneumonia pare in complex with az13053807
PDB Compounds: (A:) DNA topoisomerase IV, B subunit

SCOPe Domain Sequences for d4mbca_:

Sequence, based on SEQRES records: (download)

>d4mbca_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
lnesafllknvtlsltdkrtdeaiefhyen

Sequence, based on observed residues (ATOM records): (download)

>d4mbca_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 760835]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhavgssvvnalsswleveitrdgavykqrfengg
kpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltd
krtdeaiefhyen

SCOPe Domain Coordinates for d4mbca_:

Click to download the PDB-style file with coordinates for d4mbca_.
(The format of our PDB-style files is described here.)

Timeline for d4mbca_: