Lineage for d4l8ce2 (4l8c E:182-275)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760237Domain d4l8ce2: 4l8c E:182-275 [228367]
    Other proteins in same PDB: d4l8ca1, d4l8cb_, d4l8cc1, d4l8cd_, d4l8ce1, d4l8cf_, d4l8cg1, d4l8ch_
    automated match to d1n3na1
    complexed with so4

Details for d4l8ce2

PDB Entry: 4l8c (more details), 2.8 Å

PDB Description: crystal structure of the h2db in complex with the np-n3d peptide
PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4l8ce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8ce2 b.1.1.2 (E:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

SCOPe Domain Coordinates for d4l8ce2:

Click to download the PDB-style file with coordinates for d4l8ce2.
(The format of our PDB-style files is described here.)

Timeline for d4l8ce2: