Lineage for d4h26e2 (4h26 E:93-188)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029756Domain d4h26e2: 4h26 E:93-188 [228345]
    Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b1, d4h26b3, d4h26b4, d4h26d1, d4h26d2, d4h26e1, d4h26e3, d4h26e4
    automated match to d1d5mb1

Details for d4h26e2

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: tcr interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d4h26e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26e2 b.1.1.2 (E:93-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvhpqvtvypaktqplqhhnllvcsvsgfypgsievrwfrngqeektgvvstglihngd
wtfqtlvmletvprsgevytcqvehpsvtspltvew

SCOPe Domain Coordinates for d4h26e2:

Click to download the PDB-style file with coordinates for d4h26e2.
(The format of our PDB-style files is described here.)

Timeline for d4h26e2: