![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries) |
![]() | Domain d4h26e1: 4h26 E:3-92 [228344] Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b2, d4h26d1, d4h26d2, d4h26e2 automated match to d2sebb2 |
PDB Entry: 4h26 (more details), 2.5 Å
SCOPe Domain Sequences for d4h26e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h26e1 d.19.1.1 (E:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn sqkdlleqkrgqvdtycrhnygvvesftvq
Timeline for d4h26e1: