Lineage for d4h26e1 (4h26 E:3-92)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406849Protein automated matches [191280] (4 species)
    not a true protein
  7. 1406858Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)
  8. 1406883Domain d4h26e1: 4h26 E:3-92 [228344]
    Other proteins in same PDB: d4h26a1, d4h26a2, d4h26b2, d4h26d1, d4h26d2, d4h26e2
    automated match to d2sebb2

Details for d4h26e1

PDB Entry: 4h26 (more details), 2.5 Å

PDB Description: TCR interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
PDB Compounds: (E:) MHC class II antigen

SCOPe Domain Sequences for d4h26e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h26e1 d.19.1.1 (E:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
sqkdlleqkrgqvdtycrhnygvvesftvq

SCOPe Domain Coordinates for d4h26e1:

Click to download the PDB-style file with coordinates for d4h26e1.
(The format of our PDB-style files is described here.)

Timeline for d4h26e1: