![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
![]() | Domain d4h25d2: 4h25 D:82-182 [228337] Other proteins in same PDB: d4h25a1, d4h25b1, d4h25b2, d4h25b3, d4h25b4, d4h25d1, d4h25e1, d4h25e2, d4h25e3, d4h25e4 automated match to d1kg0a1 complexed with ipa |
PDB Entry: 4h25 (more details), 2.2 Å
SCOPe Domain Sequences for d4h25d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h25d2 b.1.1.2 (D:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
Timeline for d4h25d2: