SCOPe 2.04: Domain d4hjlb_: 4hjl B:

Lineage for d4hjlb_ (4hjl B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)

8. Domain d4hjlb_: 4hjl B: [228310]
   Other proteins in same PDB: d4hjla1, d4hjla2
   automated match to d2hmjb_
   complexed with 15o, edo, fe, fes, so4

Details for d4hjlb_

PDB Entry: 4hjl, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to 1-chloronaphthalene

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase subunit beta

SCOPe Domain Sequences for d4hjlb_:

Sequence; same for both SEQRES and ATOM records:

>d4hjlb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d4hjlb_:

• d4hjlb_ first appeared in SCOPe 2.03
  
• d4hjlb_ appears in SCOPe 2.05
  
• d4hjlb_ appears in the current release, SCOPe 2.08