Lineage for d4hjla2 (4hjl A:155-446)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669177Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1669209Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. 1669227Species Pseudomonas sp. [TaxId:69011] [228600] (14 PDB entries)
  8. 1669228Domain d4hjla2: 4hjl A:155-446 [228309]
    Other proteins in same PDB: d4hjla1, d4hjlb_
    automated match to d1eg9a2
    complexed with 15o, edo, fe, fes, so4

Details for d4hjla2

PDB Entry: 4hjl (more details), 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to 1-chloronaphthalene
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hjla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjla2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 69011]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

SCOPe Domain Coordinates for d4hjla2:

Click to download the PDB-style file with coordinates for d4hjla2.
(The format of our PDB-style files is described here.)

Timeline for d4hjla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hjla1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hjlb_