SCOPe 2.04: Domain d4hjla1: 4hjl A:1-154

Lineage for d4hjla1 (4hjl A:1-154)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (10 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:69011] [228305] (1 PDB entry)

8. Domain d4hjla1: 4hjl A:1-154 [228306]
   Other proteins in same PDB: d4hjla2, d4hjlb_
   automated match to d1o7na1
   complexed with 15o, edo, fe, fes, so4

Details for d4hjla1

PDB Entry: 4hjl, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to 1-chloronaphthalene

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hjla1:

Sequence; same for both SEQRES and ATOM records:

>d4hjla1 b.33.1.0 (A:1-154) automated matches {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d4hjla1:

• d4hjla1 first appeared in SCOPe 2.03
  
• d4hjla1 appears in SCOPe 2.05
  
• d4hjla1 appears in the current release, SCOPe 2.08