![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
![]() | Protein automated matches [190701] (13 species) not a true protein |
![]() | Species Pseudomonas sp. [TaxId:69011] [228305] (1 PDB entry) |
![]() | Domain d4hjla1: 4hjl A:1-154 [228306] Other proteins in same PDB: d4hjla2, d4hjlb_ automated match to d1o7na1 complexed with 15o, edo, fe, fes, so4 |
PDB Entry: 4hjl (more details), 1.5 Å
SCOPe Domain Sequences for d4hjla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hjla1 b.33.1.0 (A:1-154) automated matches {Pseudomonas sp. [TaxId: 69011]} mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d4hjla1: