![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (29 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225575] (5 PDB entries) |
![]() | Domain d4mpyc_: 4mpy C: [228272] automated match to d3fg0g_ complexed with na, nad |
PDB Entry: 4mpy (more details), 1.85 Å
SCOPe Domain Sequences for d4mpyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mpyc_ c.82.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]} lyfqsnamellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerail aarrafesgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddih nvfmyfagladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalat gcslvmkpseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftg gietgkhimknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsags rilvqnsikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegat iavggkrpdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqland siyglagavfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegl eeylvskhiltntnpqlvnwfsk
Timeline for d4mpyc_: