SCOPe 2.06: Domain d4i0ca_: 4i0c A:

Lineage for d4i0ca_ (4i0c A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
   Uniprot P00695

8. Domain d4i0ca_: 4i0c A: [228189]
   Other proteins in same PDB: d4i0cc1, d4i0cc2, d4i0cd1, d4i0cd2
   automated match to d1jsfa_
   complexed with cl, gol

Details for d4i0ca_

PDB Entry: 4i0c, 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d4i0ca_:

Sequence; same for both SEQRES and ATOM records:

>d4i0ca_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d4i0ca_:

• d4i0ca_ first appeared in SCOPe 2.03
  
• d4i0ca_ appears in SCOPe 2.05
  
• d4i0ca_ appears in SCOPe 2.07
  
• d4i0ca_ appears in the current release, SCOPe 2.08