SCOPe 2.07: Domain d4i0cd1: 4i0c D:1-125

Lineage for d4i0cd1 (4i0c D:1-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d4i0cd1: 4i0c D:1-125 [228187]
   Other proteins in same PDB: d4i0ca_, d4i0cb_, d4i0cc2, d4i0cd2
   automated match to d2x89a_
   complexed with cl, gol

Details for d4i0cd1

PDB Entry: 4i0c, 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme

PDB Compounds: (D:) cAbHuL5 antibody

SCOPe Domain Sequences for d4i0cd1:

Sequence; same for both SEQRES and ATOM records:

>d4i0cd1 b.1.1.1 (D:1-125) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
qvtvs

Timeline for d4i0cd1:

• d4i0cd1 first appeared in SCOPe 2.03, called d4i0cd_
  
• d4i0cd1 appears in SCOPe 2.06
  
• d4i0cd1 appears in the current release, SCOPe 2.08