Lineage for d4i0cd1 (4i0c D:1-125)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023942Domain d4i0cd1: 4i0c D:1-125 [228187]
    Other proteins in same PDB: d4i0ca_, d4i0cb_, d4i0cc2, d4i0cd2
    automated match to d2x89a_
    complexed with cl, gol

Details for d4i0cd1

PDB Entry: 4i0c (more details), 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme
PDB Compounds: (D:) cAbHuL5 antibody

SCOPe Domain Sequences for d4i0cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i0cd1 b.1.1.1 (D:1-125) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
qvtvs

SCOPe Domain Coordinates for d4i0cd1:

Click to download the PDB-style file with coordinates for d4i0cd1.
(The format of our PDB-style files is described here.)

Timeline for d4i0cd1: