SCOPe 2.05: Domain d4i0cd_: 4i0c D:

Lineage for d4i0cd_ (4i0c D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (25 PDB entries)

8. Domain d4i0cd_: 4i0c D: [228187]
   Other proteins in same PDB: d4i0ca_, d4i0cb_
   automated match to d2x89a_
   complexed with cl, gol

Details for d4i0cd_

PDB Entry: 4i0c, 1.95 Å

PDB Description: The structure of the camelid antibody cAbHuL5 in complex with human lysozyme

PDB Compounds: (D:) cAbHuL5 antibody

SCOPe Domain Sequences for d4i0cd_:

Sequence; same for both SEQRES and ATOM records:

>d4i0cd_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlsceasglsttvmawfrqapgkeregvaaiytgdgfpyyad
svkgrftisqdnaknrmylqmnslepedtamyycaaktgafsygslwwmsraynhwgqgt
qvtvssh

Timeline for d4i0cd_:

• d4i0cd_ first appeared in SCOPe 2.03
  
• d4i0cd_ appears in SCOPe 2.04
  
• d4i0cd_ is called d4i0cd1 in SCOPe 2.06
  
• d4i0cd_ appears in the current release, SCOPe 2.08, called d4i0cd1