Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein automated matches [191290] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries) |
Domain d4hkzh1: 4hkz H:4-54 [228183] Other proteins in same PDB: d4hkza1, d4hkza2, d4hkzb_, d4hkze1, d4hkze2, d4hkzh2 automated match to d1h0ta_ complexed with cl |
PDB Entry: 4hkz (more details), 2.08 Å
SCOPe Domain Sequences for d4hkzh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hkzh1 a.8.1.1 (H:4-54) automated matches {Staphylococcus aureus [TaxId: 158878]} nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa
Timeline for d4hkzh1: