SCOPe 2.08: Domain d4hkzh1: 4hkz H:4-54

Lineage for d4hkzh1 (4hkz H:4-54)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [228180] (3 PDB entries)

8. Domain d4hkzh1: 4hkz H:4-54 [228183]
   Other proteins in same PDB: d4hkza1, d4hkza2, d4hkzb_, d4hkze1, d4hkze2, d4hkzh2
   automated match to d1h0ta_
   complexed with cl

Details for d4hkzh1

PDB Entry: 4hkz, 2.08 Å

PDB Description: trastuzumab fab complexed with protein l and protein a fragments

PDB Compounds: (H:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4hkzh1:

Sequence; same for both SEQRES and ATOM records:

>d4hkzh1 a.8.1.1 (H:4-54) automated matches {Staphylococcus aureus [TaxId: 158878]}
nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

Timeline for d4hkzh1:

• d4hkzh1 first appeared in SCOPe 2.03, called d4hkzh_
  
• d4hkzh1 appears in SCOPe 2.07