Lineage for d4hkze_ (4hkz E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639537Protein automated matches [190067] (6 species)
    not a true protein
  7. 1639543Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries)
  8. 1639548Domain d4hkze_: 4hkz E: [228182]
    Other proteins in same PDB: d4hkza1, d4hkza2, d4hkzh_
    automated match to d1ymhe_
    complexed with cl

Details for d4hkze_

PDB Entry: 4hkz (more details), 2.08 Å

PDB Description: trastuzumab fab complexed with protein l and protein a fragments
PDB Compounds: (E:) Protein L fragment

SCOPe Domain Sequences for d4hkze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hkze_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 1260]}
sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
fag

SCOPe Domain Coordinates for d4hkze_:

Click to download the PDB-style file with coordinates for d4hkze_.
(The format of our PDB-style files is described here.)

Timeline for d4hkze_: