Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries) |
Domain d4hjge_: 4hjg E: [228179] Other proteins in same PDB: d4hjga1, d4hjga2, d4hjgh_ automated match to d1ymhe_ |
PDB Entry: 4hjg (more details), 2 Å
SCOPe Domain Sequences for d4hjge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hjge_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 1260]} evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikf ag
Timeline for d4hjge_: