Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [187142] (20 PDB entries) |
Domain d3zp0e_: 3zp0 E: [228155] Other proteins in same PDB: d3zp0f_ automated match to d1rvxa_ complexed with nag |
PDB Entry: 3zp0 (more details), 2.51 Å
SCOPe Domain Sequences for d3zp0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zp0e_ b.19.1.2 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlatglrnsp
Timeline for d3zp0e_: