![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (40 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188371] (5 PDB entries) |
![]() | Domain d4mqjf_: 4mqj F: [228117] Other proteins in same PDB: d4mqja_, d4mqjc_, d4mqje_, d4mqjg_ automated match to d1irdb_ complexed with cmo, hem, oxy |
PDB Entry: 4mqj (more details), 1.8 Å
SCOPe Domain Sequences for d4mqjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqjf_ a.1.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vhfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk eftpevqaswqkmvtgvasalssryh
Timeline for d4mqjf_: