Lineage for d4m76a_ (4m76 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498779Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1499052Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1499056Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 1499057Species Human (Homo sapiens) [TaxId:9606] [48253] (15 PDB entries)
  8. 1499078Domain d4m76a_: 4m76 A: [228103]
    Other proteins in same PDB: d4m76b_
    automated match to d2goxa_
    complexed with ni

Details for d4m76a_

PDB Entry: 4m76 (more details), 2.8 Å

PDB Description: Integrin I domain of complement receptor 3 in complex with C3d
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d4m76a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m76a_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
amavdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikk
gytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilek
qkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitk
agdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynve
atsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d4m76a_:

Click to download the PDB-style file with coordinates for d4m76a_.
(The format of our PDB-style files is described here.)

Timeline for d4m76a_: