SCOPe 2.08: Domain d4m76a1: 4m76 A:994-1287

Lineage for d4m76a1 (4m76 A:994-1287)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.4: Complement components [48251] (4 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (19 PDB entries)

8. Domain d4m76a1: 4m76 A:994-1287 [228103]
   Other proteins in same PDB: d4m76a2, d4m76b_
   automated match to d2goxa_
   complexed with ni

Details for d4m76a1

PDB Entry: 4m76, 2.8 Å

PDB Description: Integrin I domain of complement receptor 3 in complex with C3d

PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d4m76a1:

Sequence; same for both SEQRES and ATOM records:

>d4m76a1 a.102.4.4 (A:994-1287) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
avdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d4m76a1:

• d4m76a1 first appeared in SCOPe 2.03, called d4m76a_
  
• d4m76a1 appears in SCOPe 2.07