Lineage for d4m56a2 (4m56 A:483-561)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804631Species Bacillus subtilis [TaxId:224308] [228101] (4 PDB entries)
  8. 1804635Domain d4m56a2: 4m56 A:483-561 [228102]
    Other proteins in same PDB: d4m56a1, d4m56b1
    automated match to d1uoka1
    complexed with glo, gol, so4

Details for d4m56a2

PDB Entry: 4m56 (more details), 2.3 Å

PDB Description: the structure of wild-type mall from bacillus subtilis
PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4m56a2:

Sequence, based on SEQRES records: (download)

>d4m56a2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqer
adlksislkpyeavmgisi

Sequence, based on observed residues (ATOM records): (download)

>d4m56a2 b.71.1.0 (A:483-561) automated matches {Bacillus subtilis [TaxId: 224308]}
gdyqllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqra
dlksislkpyeavmgisi

SCOPe Domain Coordinates for d4m56a2:

Click to download the PDB-style file with coordinates for d4m56a2.
(The format of our PDB-style files is described here.)

Timeline for d4m56a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m56a1