Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d4lcwa1: 4lcw A:1-178 [228083] Other proteins in same PDB: d4lcwa2, d4lcwa3, d4lcwb_, d4lcwc2, d4lcwc3, d4lcwd1, d4lcwd2, d4lcwe1, d4lcwe2, d4lcwf_, d4lcwg1, d4lcwg2, d4lcwh1, d4lcwh2 automated match to d2bcka2 complexed with 1vy, gol |
PDB Entry: 4lcw (more details), 2.4 Å
SCOPe Domain Sequences for d4lcwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lcwa1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqaeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4lcwa1: