Lineage for d4lfhg1 (4lfh G:10-125)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519823Domain d4lfhg1: 4lfh G:10-125 [228079]
    Other proteins in same PDB: d4lfhg2
    automated match to d1hxmb1
    complexed with act, na

Details for d4lfhg1

PDB Entry: 4lfh (more details), 2.3 Å

PDB Description: Crystal Structure of 9C2 TCR
PDB Compounds: (G:) 9C2 TCR gamma chain

SCOPe Domain Sequences for d4lfhg1:

Sequence, based on SEQRES records: (download)

>d4lfhg1 b.1.1.0 (G:10-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspg
kyythtprrwswililrnliendsgvyycatwdrgnpkthyykklfgsgttlvvtd

Sequence, based on observed residues (ATOM records): (download)

>d4lfhg1 b.1.1.0 (G:10-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtksvtrptrssaeitcdltvinafyihwylhqegkapqrllyydvsnskdvlesglspg
kyythtprrwswililrnliendsgvyycatwdrykklfgsgttlvvtd

SCOPe Domain Coordinates for d4lfhg1:

Click to download the PDB-style file with coordinates for d4lfhg1.
(The format of our PDB-style files is described here.)

Timeline for d4lfhg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lfhg2