Lineage for d4j20a_ (4j20 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720291Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1720292Protein automated matches [190453] (18 species)
    not a true protein
  7. 1720302Species Chlorobium tepidum [TaxId:194439] [228039] (1 PDB entry)
  8. 1720303Domain d4j20a_: 4j20 A: [228040]
    automated match to d2v08a_
    complexed with heb, ipa, na, so4

Details for d4j20a_

PDB Entry: 4j20 (more details), 1.3 Å

PDB Description: X-ray structure of the cytochrome c-554 from chlorobaculum tepidum
PDB Compounds: (A:) Cytochrome c-555

SCOPe Domain Sequences for d4j20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j20a_ a.3.1.0 (A:) automated matches {Chlorobium tepidum [TaxId: 194439]}
stydaaagkatydascatchktgmmgapkvgdkaawapriaqgmntlvsksikgykgtkg
mmpakggnakltdaqvgnavaymvgqsk

SCOPe Domain Coordinates for d4j20a_:

Click to download the PDB-style file with coordinates for d4j20a_.
(The format of our PDB-style files is described here.)

Timeline for d4j20a_: