Lineage for d4hnsa_ (4hns A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356316Protein automated matches [190177] (7 species)
    not a true protein
  7. 1356365Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 1356368Domain d4hnsa_: 4hns A: [228035]
    automated match to d3chya_
    complexed with bef, mg

Details for d4hnsa_

PDB Entry: 4hns (more details), 2.1 Å

PDB Description: Crystal structure of activated CheY3 of Vibrio cholerae
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4hnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnsa_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
kife

SCOPe Domain Coordinates for d4hnsa_:

Click to download the PDB-style file with coordinates for d4hnsa_.
(The format of our PDB-style files is described here.)

Timeline for d4hnsa_: