Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [226740] (2 PDB entries) |
Domain d4hnra_: 4hnr A: [228033] automated match to d4h60a_ complexed with so4 |
PDB Entry: 4hnr (more details), 1.9 Å
SCOPe Domain Sequences for d4hnra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnra_ c.23.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]} tmakvlavddsisirqmvshtlqdagyevetaadgrealakaqkarfdviisdvnmpvmt gfefvkavrmqsqykftpilmlttetspekkqegkavgatgwlvkpfnpetllktlqrvl
Timeline for d4hnra_: