SCOPe 2.06: Domain d4mmwb1: 4mmw B:1-126

Lineage for d4mmwb1 (4mmw B:1-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)

8. Domain d4mmwb1: 4mmw B:1-126 [228011]
   Other proteins in same PDB: d4mmwa2, d4mmwb2
   automated match to d4hcha1
   complexed with cl, llh, mg, pge, xyh

Details for d4mmwb1

PDB Entry: 4mmw, 1.65 Å

PDB Description: Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate

PDB Compounds: (B:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4mmwb1:

Sequence; same for both SEQRES and ATOM records:

>d4mmwb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

Timeline for d4mmwb1:

• d4mmwb1 first appeared in SCOPe 2.03
  
• d4mmwb1 appears in SCOPe 2.05
  
• d4mmwb1 appears in SCOPe 2.07
  
• d4mmwb1 appears in the current release, SCOPe 2.08