Lineage for d4m48l2 (4m48 L:109-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521104Domain d4m48l2: 4m48 L:109-214 [227984]
    automated match to d1g9ml2
    complexed with 21b, cl, clr, na

Details for d4m48l2

PDB Entry: 4m48 (more details), 2.96 Å

PDB Description: x-ray structure of dopamine transporter elucidates antidepressant mechanism
PDB Compounds: (L:) 9D5 antibody, light chain

SCOPe Domain Sequences for d4m48l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m48l2 b.1.1.0 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4m48l2:

Click to download the PDB-style file with coordinates for d4m48l2.
(The format of our PDB-style files is described here.)

Timeline for d4m48l2: