SCOPe 2.05: Domain d4gunb2: 4gun B:90-206

Lineage for d4gunb2 (4gun B:90-206)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [226298] (2 PDB entries)

8. Domain d4gunb2: 4gun B:90-206 [227926]
   Other proteins in same PDB: d4guna1, d4gunb1, d4gunc1, d4gund1, d4gune1, d4gunf1, d4gung1, d4gunh1, d4guni1, d4gunj1, d4gunk1, d4gunl1, d4gunm1, d4gunn1, d4guno1, d4gunp1
   automated match to d3qvna2
   complexed with mn, so4; mutant

Details for d4gunb2

PDB Entry: 4gun, 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4gunb2:

Sequence; same for both SEQRES and ATOM records:

>d4gunb2 d.44.1.0 (B:90-206) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vskgggkhpdtssalgkqivaqygsvsnliditnsklagiqgsgwafivknkqnggaldv
vttanqdtisaphlvpiiaidawehayylqyqnvrpdyfkaiwnvinwaeaesrysa

Timeline for d4gunb2:

• d4gunb2 first appeared in SCOPe 2.03
  
• d4gunb2 appears in SCOPe 2.04
  
• d4gunb2 appears in SCOPe 2.06
  
• d4gunb2 appears in the current release, SCOPe 2.08