SCOPe 2.03: Domain d3vx0a2: 3vx0 A:382-475

Lineage for d3vx0a2 (3vx0 A:382-475)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Fungal alpha-amylase [51028] (2 species)

7. Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries)

8. Domain d3vx0a2: 3vx0 A:382-475 [227908]
   Other proteins in same PDB: d3vx0a1
   automated match to d2guya1
   complexed with ca, gd, nag

Details for d3vx0a2

PDB Entry: 3vx0, 1.5 Å

PDB Description: crystal structure of alpha-amylase from aspergillus oryzae

PDB Compounds: (A:) Alpha-amylase A type-1/2

SCOPe Domain Sequences for d3vx0a2:

Sequence; same for both SEQRES and ATOM records:

>d3vx0a2 b.71.1.1 (A:382-475) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskic

Timeline for d3vx0a2:

• d3vx0a2 is new in SCOPe 2.03-stable
  
• d3vx0a2 appears in SCOPe 2.04
  
• d3vx0a2 appears in the current release, SCOPe 2.08