Lineage for d3vx0a1 (3vx0 A:1-381)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339573Protein Fungal alpha-amylases [51462] (2 species)
  7. 1339576Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (8 PDB entries)
  8. 1339578Domain d3vx0a1: 3vx0 A:1-381 [227907]
    Other proteins in same PDB: d3vx0a2
    automated match to d2guya2
    complexed with ca, gd, nag

Details for d3vx0a1

PDB Entry: 3vx0 (more details), 1.5 Å

PDB Description: crystal structure of alpha-amylase from aspergillus oryzae
PDB Compounds: (A:) Alpha-amylase A type-1/2

SCOPe Domain Sequences for d3vx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vx0a1 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOPe Domain Coordinates for d3vx0a1:

Click to download the PDB-style file with coordinates for d3vx0a1.
(The format of our PDB-style files is described here.)

Timeline for d3vx0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vx0a2