SCOPe 2.06: Domain d4ldca1: 4ldc A:265-412

Lineage for d4ldca1 (4ldc A:265-412)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)

8. Domain d4ldca1: 4ldc A:265-412 [227898]
   Other proteins in same PDB: d4ldca2
   automated match to d1uova_
   complexed with ca, flc

Details for d4ldca1

PDB Entry: 4ldc, 1.26 Å

PDB Description: Crystal Structure of DOC2B C2B domain

PDB Compounds: (A:) Double C2-like domain-containing protein beta

SCOPe Domain Sequences for d4ldca1:

Sequence; same for both SEQRES and ATOM records:

>d4ldca1 b.7.1.0 (A:265-412) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhktav
kkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkhw
fdclknkdkrierwhtltneipgavlsd

Timeline for d4ldca1:

• d4ldca1 first appeared in SCOPe 2.03, called d4ldca_
  
• d4ldca1 was called d4ldca_ in SCOPe 2.05
  
• d4ldca1 appears in SCOPe 2.07
  
• d4ldca1 appears in the current release, SCOPe 2.08