Lineage for d4l9va_ (4l9v A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480219Species Staphylococcus aureus [TaxId:1280] [193082] (6 PDB entries)
  8. 1480232Domain d4l9va_: 4l9v A: [227886]
    automated match to d3jw4b_
    mutant

Details for d4l9va_

PDB Entry: 4l9v (more details), 2.37 Å

PDB Description: crystal structure of se-met derivative mepr f27l mutant from multidrug resistant s. aureus clinical isolate
PDB Compounds: (A:) MepR

SCOPe Domain Sequences for d4l9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l9va_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
meftysylfrmishemkqkadqkleqlditneqghtlgylyahqqdgltqndiakalqrt
gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqls
eeeneqmkanltkmlsslq

SCOPe Domain Coordinates for d4l9va_:

Click to download the PDB-style file with coordinates for d4l9va_.
(The format of our PDB-style files is described here.)

Timeline for d4l9va_: