SCOPe 2.08: Domain d4kqpa_: 4kqp A:

Lineage for d4kqpa_ (4kqp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:272623] [227880] (6 PDB entries)

8. Domain d4kqpa_: 4kqp A: [227883]
   automated match to d1hsla_
   complexed with gln

Details for d4kqpa_

PDB Entry: 4kqp, 0.95 Å

PDB Description: Crystal structure of Lactococcus lactis GlnP substrate binding domain 2 (SBD2) in complex with glutamine at 0.95 A resolution

PDB Compounds: (A:) Glutamine ABC transporter permease and substrate binding protein protein

SCOPe Domain Sequences for d4kqpa_:

Sequence; same for both SEQRES and ATOM records:

>d4kqpa_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}
atpkkdvytiasdnsfapfefqnddkqftgidvdllnaiaknqgfklkwnfigfqaavds
vqsghadgmmsgmsitdarkqvfdygspyyssnltiatsstddsikswkdlkgktlgakn
gtasfdylnahakeygytvktftdattmysslnngsinalmddepvikyaikqgqkfatp
ikpipdgqygfavkkgsnpeliemfnnglanlrangeydkiidkylesda

Timeline for d4kqpa_:

• d4kqpa_ first appeared in SCOPe 2.03
  
• d4kqpa_ appears in SCOPe 2.07