Lineage for d4bmzb1 (4bmz B:1-231)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141960Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)
  8. 2141967Domain d4bmzb1: 4bmz B:1-231 [227829]
    Other proteins in same PDB: d4bmzb2
    automated match to d4f2pb_
    complexed with mta; mutant

Details for d4bmzb1

PDB Entry: 4bmz (more details), 1.79 Å

PDB Description: Structure of futalosine hydrolase mutant of Helicobacter pylori strain 26695
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bmzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bmzb1 c.56.2.0 (B:1-231) automated matches {Helicobacter pylori [TaxId: 85962]}
mvqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstl
tttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipesai
fietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemegasv
afvcqkfgvpccvlrsisnnadeeanmsfdafleksaqtsakflksmvdel

SCOPe Domain Coordinates for d4bmzb1:

Click to download the PDB-style file with coordinates for d4bmzb1.
(The format of our PDB-style files is described here.)

Timeline for d4bmzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bmzb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bmza_